kayserievdenevenakliyatfirmalari.com
Export Report Sign up Claim Profile

No reviews yet — be the first to review kayserievdenevenakliyatfirmalari.com.

Get this data via API

Classify kayserievdenevenakliyatfirmalari.com — and any other URL — with one call.

620+ IAB categories, company data, tech stacks and logos. JSON out, real time.

curl -X POST 'https://www.klazify.com/api/categorize' \ -H 'Authorization: Bearer YOUR_API_KEY' \ -H 'Content-Type: application/json' \ -d '{"url": "https://kayserievdenevenakliyatfirmalari.com"}'
{ "domain": { "domain_url": "https://kayserievdenevenakliyatfirmalari.com", "categories": [ { "name": "/Business & Industrial/Transportation & Logistics/Moving & Relocation", "confidence": 0.98, "IAB-53-52": "Business and Finance - Business" } ] }, "success": true }
Get Free API Key View API Docs